Found 14 of ic50 data for polymerid = 50000084,50000880 
Affinity DataIC50: 4.20nMAssay Description:Inhibition of human EPHA7 using poly[Glu:Tyr] peptide substrate by Hotspot assayMore data for this Ligand-Target Pair
Affinity DataIC50: 39.2nMAssay Description:Inhibition of human EPHA7 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 56.3nMAssay Description:Inhibition of human EPHA7 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 143nMAssay Description:Inhibition of human recombinant EPHA7 (613 to 909 residues) using [protein fragment, 39 aa] incubated for 40 mins in presence of [gamma...More data for this Ligand-Target Pair
Affinity DataIC50: 162nMAssay Description:Inhibition of human wild type partial length EphA7 (Y608 to S912 residues) expressed in bacterial expression system by Kinomescan methodMore data for this Ligand-Target Pair
Affinity DataIC50: 190nMAssay Description:Inhibition of recombinant human EphA7 (613 to 909 residues) using KTFCGTPEYLAPE as substrate after 40 mins in presence of [gamma-33P]-ATP by scintill...More data for this Ligand-Target Pair
Affinity DataIC50: 199nMAssay Description:Inhibition of recombinant human EphA7 (613 to 909 residues) using [protein fragment, 39 aa] as substrate incubated for 40 mins in prese...More data for this Ligand-Target Pair
Affinity DataIC50: 665nMAssay Description:Inhibition of recombinant GST-tagged human EphA7 cytoplasmic domain expressed in baculovirus expression system by FRET assayMore data for this Ligand-Target Pair
Affinity DataIC50: <1.00E+3nMAssay Description:Concentration required to inhibit the phosphorylation of a 14-residue fragment of phospholipase C gamma 1 by Epidermal growth factor receptor from A4...More data for this Ligand-Target Pair
Affinity DataIC50: >1.00E+3nMAssay Description:Inhibition of EphA1More data for this Ligand-Target Pair
Affinity DataIC50: 1.12E+3nMAssay Description:Inhibition of EphA7 by [gamma33-P]ATP based assayMore data for this Ligand-Target Pair
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human EPHA7 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of recombinant human EphA7 (613 to 909 residues) using KTFCGTPEYLAPE as substrate measured after 40 mins in presence of [gamma33ATP] by ra...More data for this Ligand-Target Pair
Affinity DataIC50: >3.00E+4nMAssay Description:Displacement of biotinylated ephrin-A1-Fc from mouse EphA7 Fc preincubated for 1 hr followed by ephrin-A1-FC addition and measured after 4 hrs by ELI...More data for this Ligand-Target Pair
